PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678458376
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SRS
Protein Properties Length: 330aa    MW: 34237.1 Da    PI: 7.6593
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678458376genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702203.55.8e-631182573154
     DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkelet 102
                 g++sCqdCGnqakkdCah+RCRtCCksrgf+C+thvkstWvpaakrrerqqq+  a+++        + kr+re+  + +++l++t++++++    let
  678458376 118 GGGISCQDCGNQAKKDCAHMRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQQPEAAATP------PSGKRPRET-PAISNSLACTRIPTSS---GLET 207
                5789**********************************************99998875555......457888886.8888999999999874...7899 PP

     DUF702 103 sslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                 ++P+ev ++avfrcvrvs+vd+  +++aYq+av+i Gh+fkGiLydqG+e+
  678458376 208 GDFPSEVTAPAVFRCVRVSAVDE--DQFAYQAAVNIRGHLFKGILYDQGTEA 257
                9********************96..79**********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.1E-58120256IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.9E-27122164IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016244.9E-23210254IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MAGFFTLGAA AAGGGATDQP PSSEIHPENW FLLRNEESVV PVSVPVPVPV PYRGFELWQQ  60
QQQQQQGPGQ GENNPLQELY ASAGVLAVGP SRGGGGLGDG SRSGFLMMRS GAASASGGGG  120
ISCQDCGNQA KKDCAHMRCR TCCKSRGFQC QTHVKSTWVP AAKRRERQQQ QPEAAATPPS  180
GKRPRETPAI SNSLACTRIP TSSGLETGDF PSEVTAPAVF RCVRVSAVDE DQFAYQAAVN  240
IRGHLFKGIL YDQGTEAQYL AASAAGDTSS GGGSISAGGQ PLNLITGTSA AATPSAPTGG  300
TALPLLDPSF YPAPINSFMA GTQFFPQSRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100954.11e-115PREDICTED: protein SHORT INTERNODES
SwissprotQ9XGX02e-79SHI_ARATH; Protein SHORT INTERNODES
TrEMBLS8C9901e-110S8C990_9LAMI; Uncharacterized protein
STRINGSolyc02g084680.2.11e-93(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67824110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.15e-58Lateral root primordium (LRP) protein-related